Commit Graph

6205 Commits

Author SHA1 Message Date
Jordan Brown 38e8bdeaeb Merge pull request #34500 from Xhuis/recallfix
fixes a mass recall runtime error that prevented it from working
2018-01-17 08:09:10 -05:00
Ashe Higgs ea5924bca8 Reebe rifts no longer instantly teleport you on collision, and servant blockers also block airflow (#34427)
* Portal tweaks, and blocked atmos

* Update servant_blocker.dm

* Update servant_blocker.dm

* Update servant_blocker.dm
2018-01-17 09:33:19 +13:00
Jordan Brown c20ae96884 Merge pull request #34478 from ChangelingRain/runtimefix
Fixes a variety of runtimes that happen if a servant tries to access scripture without servants being properly active
2018-01-16 09:32:00 -05:00
Xhuis 77b4d36056 fixes hte mass recall not working 2018-01-15 20:07:55 -05:00
kevinz000 0c1a1ee80b Lowers ark volume 2018-01-15 15:04:34 -06:00
Joan Lung 162416946a Fixes a variety of runtimes that happen if a servant tries to access scripture without servants being properly active 2018-01-15 12:56:19 -05:00
ShizCalev 3d08996463 Replaces cached get_area vars for names (#34338) 2018-01-13 21:55:47 -05:00
Tad Hardesty 5caa23cbe3 Fix the Ark's z-level checks 2018-01-12 07:10:07 -08:00
MoreRobustThanYou e5bf835103 Sigils of submission now uncuff upon successful conversion (#34174)
* Sigils of submission now uncuff upon successful conversion

No more retards forgetting to uncuff after conversion

* Update clock_sigils.dm
2018-01-11 22:50:27 -05:00
Jordan Brown f1e3e9e9ed Fixes brass skewer grammar 2018-01-11 21:26:11 -06:00
kevinz000 18ec790ff3 Update ark_of_the_clockwork_justicar.dm (#34297) 2018-01-11 22:24:11 -05:00
Tad Hardesty 827c4b3f99 Replace hardcoded z-level numbers with a trait system (#34090)
* Add basic structure of z-level traits

* Restore space transitions and add z-level debug verb

* Restore proper ruin spawning and transit level creation

* Replace station_z_levels and related checks with traits

* Eliminate more uses of ZLEVEL_{STATION_PRIMARY,LAVALAND}
2018-01-12 09:05:49 +13:00
Robustin 82bde09836 Cult will actually report victories now (#34096)
* Cult victory fix

* Update cult.dm

* Correct cult victory report
2018-01-10 10:46:28 +01:00
oranges 41b06b0c31 Merge pull request #33933 from coiax/wizard-late-joining
Late joiners also get summoned guns/magic
2018-01-10 18:50:14 +13:00
Leo 3d0cad9a3e Merge pull request #34185 from Jordie0608/quickenedspellislameanywaypicktwinnedandempoweredinsteadorsubtleifyouhatenpcs
Fixes feedback spell level var
2018-01-09 21:00:06 -02:00
Jordan Brown 5ea4285e9c Merge pull request #34160 from ShizCalev/cult-blade-drop
Fixes non-cultist hulks being able to hold cult bbs
2018-01-09 13:28:31 -08:00
Ashe Higgs f0f78000d2 Fixes vitality matrices giving massively more vitality than they should (#33768)
* Fixes vitality matrix shenanigans

* Replaces the spawn_dust() with a variable check

* Update clock_sigils.dm
2018-01-08 10:50:28 +01:00
Jordie0608 dfa909ec91 fixes spell level var 2018-01-08 18:38:40 +11:00
Dax Dupont c1310366e5 Makes the chaplain's soulshard require death (#34125) 2018-01-07 21:55:55 -05:00
oranges c8ad5a6314 Clean up a bunch of undefined arg runtimes (#34105)
* Clean up a bunch of undefined arg runtimes

Ensure subtypes have the appropriate arguments, do a bit of code cleanup
and remove some uneeded emote procs that also caused runtimes

* Fix up all calls to canUseTopic, add the dexterity flag

* Runtime with missing force argument in borg unbuckle mob
2018-01-07 21:52:56 -05:00
MoreRobustThanYou ca1da30f55 Adds spaceturf check to blob overmind spawning (#34100)
* Adds spaceturf check to blob/proc/validate_location()

* Fixes possible bombing of blobstart locs

* Update overmind.dm
2018-01-07 21:51:52 -05:00
Ashe Higgs f42d5a43ca Servants are now moved to and restricted to Reebe when the Ark starts; also updates the CC changelog (#33645)
* Objects touched by servants now warp to the Ark

* Check by servant

* Replaces with a baselock

* Updates the 'log
2018-01-07 21:18:14 -05:00
ShizCalev 518299efc9 Fixes hulks being able to hold cult bbs 2018-01-06 18:12:33 -05:00
ShiggyDiggyDo 32a205b8e7 You now have to stand next to the decoy nuke disk and examine it to know it's fake (#34059)
* Changed name of the fake nuclear authentication disk from "cheap plastic imitation of the nuclear authentication disk" to "nuclear authentication disk" and the description from "Broken dreams and a faint odor of cheese" to "A cheap plastic imitation of the nuclear authentication disk. Smells like broken dreams and cheese."

* Adjacent players can see that it's fake
2018-01-04 09:55:07 -02:00
Leo 0fa15b4458 Merge pull request #34060 from AnturK/brotherfix
Fixes brothers not assigning properly.
2018-01-04 09:53:53 -02:00
Jordan Brown 4db7bfd44e Merge pull request #34031 from ShizCalev/narsie-summons
Prevents Nar-Sie from being double-summoned
2018-01-03 10:25:02 -08:00
AnturK c6cfb5fa51 Fixes brothers not assigning properly. 2018-01-03 11:36:05 +01:00
AnturK ecf47115d1 Fixes marauder ghostclick jump 2018-01-02 15:27:03 +01:00
ShizCalev 391274eb94 Prevents Nar-Sie from being double-summoned 2018-01-01 19:36:41 -05:00
F-OS 47cd2fbd55 Last resort now requires a confirmation. (#33947)
* Update headcrab.dm

* fixed

* fuck

* Update headcrab.dm

* Update headcrab.dm
2017-12-31 03:23:42 -05:00
oranges e84a7f3243 Merge pull request #33580 from Xhuis/defenses_balancing
Some modest clockcult balancing - vitality matrices, brass skewers, pressure sensors
2017-12-31 11:58:41 +13:00
Jack Edge eed34adc0d Late joiners also get summoned guns/magic
🆑 coiax
add: If you have the (mis)fortune of late joining a shift where a crazy
wizard has given magical items or firearms to the crew, you will find
yourself also carrying such equipment.
/🆑

- Scrying orb now just grants the XRAY mutation to the first human that
picks it up
- The chance of a "special" magical item is now 1/50, up/down from 0-1
times per summon magic.
- The suppressor option in summon guns has been changed from a stetchkin
plus a silencer, to just a stetchkin with a silencer pre-installed.
- The summon magic/gun tables are now global typelists, rather than a
godforsaken giant switch statement
- Badmins can call the global /proc/give_guns(human) or
/proc/give_magic(human) for all their badmin needs.
- The chance of new players being survivor antags is the last effect
that triggered summon guns/magic (25 for wizard, 10 for summon event).
2017-12-29 22:20:26 +00:00
Tad Hardesty f2dbe5cf13 Replace explicit z-level checks with defines (#33829)
* Replace explicit z-level checks with defines

* Rename turf_z_is_planet for consistency

* Use TRUE/FALSE in onSyndieBase
2017-12-29 14:40:06 -05:00
XDTM d3e798c649 Corrects abductor uncuffing message (#33895)
* Corrects abductor uncuffing message

* breaks
2017-12-29 03:54:50 -05:00
MoreRobustThanYou bd06581800 The Radiance (eminence after ratvar awakens) can now ignore chapel tiles (#33873) 2017-12-29 03:53:59 -05:00
Robustin 329bd7aa1a Dead cultists can now cross Reebe's "Servant Blocker" (#33558)
* Dead Cultist Exception

* Servant blocker update

* Corpse balance

* Lets corpses pass servant blocker

* Lets cult corpses pass servant blocker

* Update servant_blocker.dm

* Update open.dm

* Update servant_blocker.dm

* Update open.dm
2017-12-28 13:33:38 -05:00
oranges 9d0e97fc8d Merge pull request #32311 from kevinz000/component_forensics
MoreRobustThanYou's datum forensics but it's a component this time.
Fully refactors forensics, including fingerprints, hidden/admin fingerprints, suit/clothing/whatever fibers, and blood DNA residue to /datum/component/forensics.
Adds support for manually adding fingerprints.
🆑
code: Forensics is now a datum component.
balance: NPC humans will now start leaving fingerprints on things they touch!
/🆑
2017-12-28 10:18:11 +13:00
Jordan Brown 585674c8c3 Merge pull request #33834 from Xhuis/drone_hats
Drones now spawn with seasonal hats depending on active holidays [VERY Important PR]
2017-12-26 19:37:45 -05:00
ShizCalev 3d5c1ea4d1 Fixes deleting handcuffs (#33821)
* Fixes deleting handcuffs

* cleanup
2017-12-26 01:12:40 -05:00
Emmett Gaines 4595c46dca turns the baseturf var into a part time list (#33705) 2017-12-25 20:10:08 -05:00
Xhuis d70740412e Uses locate() instead of a for 2017-12-25 16:39:09 -05:00
Xhuis ddfc9759bc Seasonal drone hats 2017-12-25 01:29:39 -05:00
kevinz000 05be346f8a Component Forensics, Blood Decals, and Cleaning 2017-12-24 18:19:43 -08:00
Jordan Brown 7fac86cfa8 Merge pull request #33801 from AutomaticFrenzy/patch/download
Fix download objective always greentexting
2017-12-24 14:52:31 -05:00
Jordan Brown bc20a758d5 Merge pull request #33783 from Cruix/fix_blind
Prefixed all disability defines with DISABILITY_ to fix a name collision
2017-12-24 11:45:45 -05:00
Tad Hardesty 90352ffbd6 Fix download objective always greentexting 2017-12-23 14:16:42 -08:00
Jordan Brown 8a3d84b8f4 Merge pull request #33784 from octareenroon91/patch-56
Fix file path to aimalf.ogg
2017-12-23 09:30:31 -05:00
Jordan Brown 4d7954d540 Merge pull request #33728 from kevinz000/patch-408
Fixes biodegrading handcuffs
2017-12-23 09:26:23 -05:00
AnturK 619a83f7bc Fixes eminence login (#33752) 2017-12-23 12:13:05 -02:00
octareenroon91 8051dae512 Fix file path to aimalf.ogg 2017-12-23 02:50:47 -06:00